Ergebnis der Datenbankabfrage

Nr.	Titel	Autor	Jahr
1	Investigations into high-velocity combustion wire spraying	Wielage, Bernhard et al.	2008
2	Schichtentwicklung für die schmiermittelfreie Umformung von hochfesten Aluminiumwerkstoffen	Wielage, Bernhard et al.	2008
3	Study on the Properties of a New HVOF Spraying Gun	Wank, A. et al.	2008
4	An improvement of corrosion resistance of Mg alloys by physical and chemical surface treatment	Kwiatkowski, L. et al.	2007
5	Behaviour of thermally sprayed wear protective coatings exposed to different abrasive wear conditions in comparison to hard chromium plating	Wank, A. et al.	2007
6	Development and Evaluation of Coatings for Lubricant Free Forming of High Strength Aluminium	Wielage, Bernhard et al.	2007
7	Investigations on thermal spray coatings resistance against abrasion dominated tribological load in comparison to hard chromium coatings	Wank, A. et al.	2007
8	Plasma electrolytic oxidation of arc sprayed aluminium coatings	Pokhmurskii, V. et al.	2007
9	Plasma electrolytic oxidation of arc sprayed aluminium coatings	Pokhmurskii, V. et al.	2007
10	Schichtentwicklung sowie experimentelle und numerische Untersuchungen an Schicht-Substrat-Systemen	Wank, A. et al.	2007
11	Simulation of Nanoindentation and Penetration Tests for Coating-Substrate-Characterisation	Leopold, J. et al.	2007
12	Untersuchungen zum Hochgeschwindigkeitsdrahtflammspritzen	Wielage, Bernhard et al.	2007